PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family Dof
Protein Properties Length: 308aa    MW: 32876.6 Da    PI: 9.7429
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529029.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.7e-402282262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++++lkcprC+s+ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+P+Ggg+rkn k+s
  XP_010529029.1 22 EQEQLKCPRCESMNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNIPIGGGSRKNTKRS 82
                    57899****************************************************9876 PP

2zf-Dof46.38.9e-151742013562
          zf-Dof  35 aCrryWtkGGalrnvPvGggrrknkkss 62 
                     +CrryWtkGGalrn+P+Ggg+rkn k+s
  XP_010529029.1 174 SCRRYWTKGGALRNIPIGGGSRKNTKRS 201
                     6***********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-291781IPR003851Zinc finger, Dof-type
PfamPF027011.7E-332480IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1992680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-7158199IPR003851Zinc finger, Dof-type
PfamPF027011.4E-9174199IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MQDQSAGSYY QAMMLKQPQF PEQEQLKCPR CESMNTKFCY YNNYNLSQPR HFCKSCRRYW  60
TKGGALRNIP IGGGSRKNTK RSKKTPSVKN PDQNSGSGSS RVPGQGHDPA GLMYGLQIGD  120
QDVKGADLGG SFRSLLASNM QLGGIILDGF GETGSGWDLG LGLPRSDSVN DEGSCRRYWT  180
KGGALRNIPI GGGSRKNTKR SKKTPSVKNP DQNSGSGSSR VPGQGHDPAG LMYGLQIGDQ  240
DVKGADLGGS FRSLLASNMQ LGGIILDGFG ETGSGWDLGL GLPRSDSVKD DGGGGGWTDH  300
AMNRVEKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529029.10.0PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotO821552e-60DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLD7L0R04e-63D7L0R0_ARALL; Putative uncharacterized protein
STRINGscaffold_302540.11e-62(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-62DOF zinc finger protein 1